Recombinant Full Length Human FOLR2 Protein, GST-tagged
Cat.No. : | FOLR2-5036HF |
Product Overview : | Human FOLR2 full-length ORF ( AAH58036.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 255 amino acids |
Description : | The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOLR2 folate receptor 2 (fetal) [ Homo sapiens ] |
Official Symbol | FOLR2 |
Synonyms | FOLR2; folate receptor 2 (fetal); folate receptor beta; FBP; folate receptor, beta; folate receptor, fetal/placental; placental folate-binding protein; folate-binding protein, fetal/placental; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1; |
Gene ID | 2350 |
mRNA Refseq | NM_000803 |
Protein Refseq | NP_000794 |
MIM | 136425 |
UniProt ID | P14207 |
◆ Recombinant Proteins | ||
FOLR2-2815H | Recombinant Human FOLR2 Protein (19-230 aa), His-tagged | +Inquiry |
FOLR2-1737R | Recombinant Rhesus monkey FOLR2 Protein, His-tagged | +Inquiry |
FOLR2-1435C | Active Recombinant Cynomolgus FOLR2 protein, His-tagged | +Inquiry |
FOLR2-5968M | Recombinant Mouse FOLR2 Protein | +Inquiry |
FOLR2-2532H | Recombinant Human FOLR2 Protein (Thr17-Asn230), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR2-2541HCL | Recombinant Human FOLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLR2 Products
Required fields are marked with *
My Review for All FOLR2 Products
Required fields are marked with *
0
Inquiry Basket