Recombinant Full Length Human FOSL2 Protein, GST-tagged

Cat.No. : FOSL2-5043HF
Product Overview : Human FOSL2 full-length ORF ( AAH08899, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 122 amino acids
Description : The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq
Molecular Mass : 39.16 kDa
AA Sequence : MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOSL2 FOS-like antigen 2 [ Homo sapiens ]
Official Symbol FOSL2
Synonyms FOSL2; FOS-like antigen 2; fos-related antigen 2; FLJ23306; FRA2; FRA-2;
Gene ID 2355
mRNA Refseq NM_005253
Protein Refseq NP_005244
MIM 601575
UniProt ID P15408

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOSL2 Products

Required fields are marked with *

My Review for All FOSL2 Products

Required fields are marked with *

0
cart-icon