Recombinant Human FOSL2 protein, His-SUMO-tagged
Cat.No. : | FOSL2-2927H |
Product Overview : | Recombinant Human FOSL2 protein(P15408)(1-326aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-326aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FOSL2 FOS-like antigen 2 [ Homo sapiens ] |
Official Symbol | FOSL2 |
Synonyms | FOSL2; FOS-like antigen 2; fos-related antigen 2; FLJ23306; FRA2; FRA-2; |
Gene ID | 2355 |
mRNA Refseq | NM_005253 |
Protein Refseq | NP_005244 |
MIM | 601575 |
UniProt ID | P15408 |
◆ Recombinant Proteins | ||
FOSL2-4428H | Recombinant Human FOSL2 Protein, GST-tagged | +Inquiry |
FOSL2-5043HF | Recombinant Full Length Human FOSL2 Protein, GST-tagged | +Inquiry |
FOSL2-2927H | Recombinant Human FOSL2 protein, His-SUMO-tagged | +Inquiry |
FOSL2-1739R | Recombinant Rhesus monkey FOSL2 Protein, His-tagged | +Inquiry |
FOSL2-799H | Recombinant Human FOSL2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL2-6165HCL | Recombinant Human FOSL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL2 Products
Required fields are marked with *
My Review for All FOSL2 Products
Required fields are marked with *