Recombinant Human FOSL2 protein, His-SUMO-tagged
| Cat.No. : | FOSL2-2927H |
| Product Overview : | Recombinant Human FOSL2 protein(P15408)(1-326aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-326aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.2 kDa |
| AA Sequence : | MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FOSL2 FOS-like antigen 2 [ Homo sapiens ] |
| Official Symbol | FOSL2 |
| Synonyms | FOSL2; FOS-like antigen 2; fos-related antigen 2; FLJ23306; FRA2; FRA-2; |
| Gene ID | 2355 |
| mRNA Refseq | NM_005253 |
| Protein Refseq | NP_005244 |
| MIM | 601575 |
| UniProt ID | P15408 |
| ◆ Recombinant Proteins | ||
| FOSL2-5974M | Recombinant Mouse FOSL2 Protein | +Inquiry |
| FOSL2-799H | Recombinant Human FOSL2 Protein, His-tagged | +Inquiry |
| FOSL2-1739R | Recombinant Rhesus monkey FOSL2 Protein, His-tagged | +Inquiry |
| FOSL2-3495C | Recombinant Chicken FOSL2 | +Inquiry |
| FOSL2-5043HF | Recombinant Full Length Human FOSL2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOSL2-6165HCL | Recombinant Human FOSL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL2 Products
Required fields are marked with *
My Review for All FOSL2 Products
Required fields are marked with *
