Recombinant Full Length Human FSCN3 Protein, GST-tagged
Cat.No. : | FSCN3-5080HF |
Product Overview : | Human FSCN3 full-length ORF ( NP_065102.1, 1 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 498 amino acids |
Description : | FSCN3 (Fascin Actin-Bundling Protein 3) is a Protein Coding gene. Diseases associated with FSCN3 include Hodgkin's Lymphoma, Lymphocytic Depletion and Colloid Carcinoma Of The Pancreas. Among its related pathways are MAPK-Erk Pathway. GO annotations related to this gene include actin filament binding and protein binding, bridging. An important paralog of this gene is FSCN1. |
Molecular Mass : | 83 kDa |
AA Sequence : | MDETEWIHRHPKAEDLRVGLISWAGTYLTFEACKNTVTATAKSLGRRQTWEILVSNEHETQAVVRLKSVQGLYLLCECDGTVCYGRPRTSHHGCFLLRFHRNSKWTLQCLISGRYLESNGKDVFCTSHVLSAYHMWTPRPALHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FSCN3 fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus) [ Homo sapiens ] |
Official Symbol | FSCN3 |
Synonyms | FSCN3; fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus); fascin (Strongylocentrotus purpuratus) homolog 3 (actin bundling protein, testicular); fascin-3; testis fascin; |
Gene ID | 29999 |
mRNA Refseq | NM_020369 |
Protein Refseq | NP_065102 |
MIM | 615800 |
UniProt ID | Q9NQT6 |
◆ Recombinant Proteins | ||
FSCN3-4513H | Recombinant Human FSCN3 Protein, GST-tagged | +Inquiry |
FSCN3-6056M | Recombinant Mouse FSCN3 Protein | +Inquiry |
FSCN3-3372M | Recombinant Mouse FSCN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FSCN3-1483H | Recombinant Human FSCN3 | +Inquiry |
FSCN3-5080HF | Recombinant Full Length Human FSCN3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSCN3 Products
Required fields are marked with *
My Review for All FSCN3 Products
Required fields are marked with *