Recombinant Human FSCN3 Protein, GST-tagged

Cat.No. : FSCN3-4513H
Product Overview : Human FSCN3 full-length ORF ( NP_065102.1, 1 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FSCN3 (Fascin Actin-Bundling Protein 3) is a Protein Coding gene. Diseases associated with FSCN3 include Hodgkin's Lymphoma, Lymphocytic Depletion and Colloid Carcinoma Of The Pancreas. Among its related pathways are MAPK-Erk Pathway. GO annotations related to this gene include actin filament binding and protein binding, bridging. An important paralog of this gene is FSCN1.
Molecular Mass : 83 kDa
AA Sequence : MDETEWIHRHPKAEDLRVGLISWAGTYLTFEACKNTVTATAKSLGRRQTWEILVSNEHETQAVVRLKSVQGLYLLCECDGTVCYGRPRTSHHGCFLLRFHRNSKWTLQCLISGRYLESNGKDVFCTSHVLSAYHMWTPRPALHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FSCN3 fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus) [ Homo sapiens ]
Official Symbol FSCN3
Synonyms FSCN3; fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus); fascin (Strongylocentrotus purpuratus) homolog 3 (actin bundling protein, testicular); fascin-3; testis fascin;
Gene ID 29999
mRNA Refseq NM_020369
Protein Refseq NP_065102
MIM 615800
UniProt ID Q9NQT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSCN3 Products

Required fields are marked with *

My Review for All FSCN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon