Recombinant Full Length Human FTH1 Protein, C-Flag-tagged

Cat.No. : FTH1-410HFL
Product Overview : Recombinant Full Length Human FTH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 21 kDa
AA Sequence : MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN
EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNESTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Porphyrin and chlorophyll metabolism
Full Length : Full L.
Gene Name FTH1 ferritin heavy chain 1 [ Homo sapiens (human) ]
Official Symbol FTH1
Synonyms FHC; FTH; HFE5; PLIF; FTHL6; PIG15
Gene ID 2495
mRNA Refseq NM_002032.3
Protein Refseq NP_002023.2
MIM 134770
UniProt ID P02794

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTH1 Products

Required fields are marked with *

My Review for All FTH1 Products

Required fields are marked with *

0
cart-icon