Recombinant Full Length Human FTH1 Protein, C-Flag-tagged
Cat.No. : | FTH1-410HFL |
Product Overview : | Recombinant Full Length Human FTH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21 kDa |
AA Sequence : | MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Porphyrin and chlorophyll metabolism |
Full Length : | Full L. |
Gene Name | FTH1 ferritin heavy chain 1 [ Homo sapiens (human) ] |
Official Symbol | FTH1 |
Synonyms | FHC; FTH; HFE5; PLIF; FTHL6; PIG15 |
Gene ID | 2495 |
mRNA Refseq | NM_002032.3 |
Protein Refseq | NP_002023.2 |
MIM | 134770 |
UniProt ID | P02794 |
◆ Recombinant Proteins | ||
FTH1-569H | Recombinant Human FTH1 Protein (Met1-Ser183) | +Inquiry |
Fth1-8241R | Recombinant Rat Fth1 protein, His-tagged | +Inquiry |
FTH1-942H | Recombinant Human FTH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FTH1-8240P | Recombinant Pig FTH1 protein, His-tagged | +Inquiry |
FTH1-4531H | Recombinant Human FTH1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FTH1-28156TH | Native Human FTH1 | +Inquiry |
FTH1-001H | Native Horse FTH1 Protein | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTH1-6128HCL | Recombinant Human FTH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTH1 Products
Required fields are marked with *
My Review for All FTH1 Products
Required fields are marked with *
0
Inquiry Basket