Recombinant Full Length Human FTSJ1 Protein, GST-tagged

Cat.No. : FTSJ1-5126HF
Product Overview : Human FTSJ1 full-length ORF ( AAH23584, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 329 amino acids
Description : The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Molecular Mass : 61.93 kDa
AA Sequence : MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FTSJ1 FtsJ homolog 1 (E. coli) [ Homo sapiens ]
Official Symbol FTSJ1
Synonyms FTSJ1; FtsJ homolog 1 (E. coli); mental retardation, X linked 9, mental retardation, X linked 44, MRX9, MRX44; putative ribosomal RNA methyltransferase 1; CDLIV; JM23; SPB1; TRM7; cell division protein; protein ftsJ homolog 1; rRNA (uridine-2-O-)-methyltransferase; MRX9; MRX44;
Gene ID 24140
mRNA Refseq NM_012280
Protein Refseq NP_036412
MIM 300499
UniProt ID Q9UET6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTSJ1 Products

Required fields are marked with *

My Review for All FTSJ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon