Recombinant Human FTSJ1 Protein, GST-tagged
Cat.No. : | FTSJ1-4536H |
Product Overview : | Human FTSJ1 full-length ORF ( AAH23584, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq |
Molecular Mass : | 61.93 kDa |
AA Sequence : | MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTDLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FTSJ1 FtsJ homolog 1 (E. coli) [ Homo sapiens ] |
Official Symbol | FTSJ1 |
Synonyms | FTSJ1; FtsJ homolog 1 (E. coli); mental retardation, X linked 9, mental retardation, X linked 44, MRX9, MRX44; putative ribosomal RNA methyltransferase 1; CDLIV; JM23; SPB1; TRM7; cell division protein; protein ftsJ homolog 1; rRNA (uridine-2-O-)-methyltransferase; MRX9; MRX44; |
Gene ID | 24140 |
mRNA Refseq | NM_012280 |
Protein Refseq | NP_036412 |
MIM | 300499 |
UniProt ID | Q9UET6 |
◆ Recombinant Proteins | ||
FTSJ1-1580R | Recombinant Rhesus Macaque FTSJ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FTSJ1-1759R | Recombinant Rhesus monkey FTSJ1 Protein, His-tagged | +Inquiry |
FTSJ1-5126HF | Recombinant Full Length Human FTSJ1 Protein, GST-tagged | +Inquiry |
FTSJ1-4536H | Recombinant Human FTSJ1 Protein, GST-tagged | +Inquiry |
FTSJ1-510H | Recombinant Human FTSJ1 Protein (1-329 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTSJ1-6124HCL | Recombinant Human FTSJ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTSJ1 Products
Required fields are marked with *
My Review for All FTSJ1 Products
Required fields are marked with *