Recombinant Full Length Human FXYD2 Protein, Flag tagged

• Cat.No.: FXYD2-01HFL
• Product Overview: Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-66 aa
• Description: This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 7.1 kDa
• AASequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: >0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens (human) ]
• Official Symbol: FXYD2
• Synonyms: FXYD2; FXYD domain containing ion transport regulator 2; ATP1G1, HOMG2, hypomagnesemia 2, renal; sodium/potassium-transporting ATPase subunit gamma; MGC12372; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; HOMG2; ATP1G1
• Gene ID: 486
• mRNA Refseq: NM_001680
• Protein Refseq: NP_001671
• MIM: 601814
• UniProt ID: P54710