Recombinant Human FXYD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FXYD2-551H
Product Overview : FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.
Molecular Mass : 7.3 kDa
AA Sequence : MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens (human) ]
Official Symbol FXYD2
Synonyms FXYD2; FXYD domain containing ion transport regulator 2; ATP1G1, HOMG2, hypomagnesemia 2, renal; sodium/potassium-transporting ATPase subunit gamma; MGC12372; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; HOMG2; ATP1G1;
Gene ID 486
mRNA Refseq NM_001680
Protein Refseq NP_001671
MIM 601814
UniProt ID P54710

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXYD2 Products

Required fields are marked with *

My Review for All FXYD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon