Recombinant Full Length Human G-Protein Coupled Receptor Family C Group 5 Member B(Gprc5B) Protein, His-Tagged
Cat.No. : | RFL406HF |
Product Overview : | Recombinant Full Length Human G-protein coupled receptor family C group 5 member B(GPRC5B) Protein (Q9NZH0) (29-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-403) |
Form : | Lyophilized powder |
AA Sequence : | ENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKE KKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVR RLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDM VLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWN DPTLAITLAASGWVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPR AYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGG TIPTAPPSHTGRHLW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPRC5B |
Synonyms | GPRC5B; RAIG2; G-protein coupled receptor family C group 5 member B; A-69G12.1; Retinoic acid-induced gene 2 protein; RAIG-2 |
UniProt ID | Q9NZH0 |
◆ Recombinant Proteins | ||
GPRC5B-5286H | Recombinant Human GPRC5B Protein, GST-tagged | +Inquiry |
RFL406HF | Recombinant Full Length Human G-Protein Coupled Receptor Family C Group 5 Member B(Gprc5B) Protein, His-Tagged | +Inquiry |
GPRC5B-5544HF | Recombinant Full Length Human GPRC5B Protein, GST-tagged | +Inquiry |
GPRC5B-5285H | Recombinant Human GPRC5B Protein | +Inquiry |
GPRC5B-1846H | Recombinant Human GPRC5B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRC5B-5770HCL | Recombinant Human GPRC5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5B Products
Required fields are marked with *
My Review for All GPRC5B Products
Required fields are marked with *