Recombinant Human GPRC5B protein, GST-tagged

Cat.No. : GPRC5B-1846H
Product Overview : Recombinant Human GPRC5B protein(293-331 aa), fused to GST tag, was expressed in E. coli.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 293-331 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : HCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYM
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GPRC5B G protein-coupled receptor, family C, group 5, member B [ Homo sapiens ]
Official Symbol GPRC5B
Synonyms GPRC5B; G protein-coupled receptor, family C, group 5, member B; G protein coupled receptor, family C, group 1, member B; G-protein coupled receptor family C group 5 member B; RAIG 2; A-69G12.1; retinoic acid-induced gene 2 protein; retinoic acid responsive gene protein; G protein-coupled receptor, family C, group 1, member B; RAIG2; RAIG-2;
Gene ID 51704
mRNA Refseq NM_016235
Protein Refseq NP_057319
MIM 605948
UniProt ID Q9NZH0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPRC5B Products

Required fields are marked with *

My Review for All GPRC5B Products

Required fields are marked with *

0
cart-icon
0
compare icon