Recombinant Human GPRC5B protein, GST-tagged
Cat.No. : | GPRC5B-1846H |
Product Overview : | Recombinant Human GPRC5B protein(293-331 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 293-331 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | HCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GPRC5B G protein-coupled receptor, family C, group 5, member B [ Homo sapiens ] |
Official Symbol | GPRC5B |
Synonyms | GPRC5B; G protein-coupled receptor, family C, group 5, member B; G protein coupled receptor, family C, group 1, member B; G-protein coupled receptor family C group 5 member B; RAIG 2; A-69G12.1; retinoic acid-induced gene 2 protein; retinoic acid responsive gene protein; G protein-coupled receptor, family C, group 1, member B; RAIG2; RAIG-2; |
Gene ID | 51704 |
mRNA Refseq | NM_016235 |
Protein Refseq | NP_057319 |
MIM | 605948 |
UniProt ID | Q9NZH0 |
◆ Cell & Tissue Lysates | ||
GPRC5B-5770HCL | Recombinant Human GPRC5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5B Products
Required fields are marked with *
My Review for All GPRC5B Products
Required fields are marked with *