Recombinant Full Length Human G3BP1 Protein, C-Flag-tagged
Cat.No. : | G3BP1-766HFL |
Product Overview : | Recombinant Full Length Human G3BP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52 kDa |
AA Sequence : | MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNF TNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGG FVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEI QEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPAS QPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHE VDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | G3BP1 G3BP stress granule assembly factor 1 [ Homo sapiens (human) ] |
Official Symbol | G3BP1 |
Synonyms | G3BP; HDH-VIII |
Gene ID | 10146 |
mRNA Refseq | NM_005754.3 |
Protein Refseq | NP_005745.1 |
MIM | 608431 |
UniProt ID | Q13283 |
◆ Recombinant Proteins | ||
G3BP1-2933H | Recombinant Human G3BP1 protein(1-466aa), His-tagged | +Inquiry |
G3BP1-6127M | Recombinant Mouse G3BP1 Protein | +Inquiry |
G3BP1-13076H | Recombinant Human G3BP1, GST-tagged | +Inquiry |
G3bp1-3122M | Recombinant Mouse G3bp1 Protein, Myc/DDK-tagged | +Inquiry |
G3BP1-1302C | Recombinant Chicken G3BP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
G3BP1-6085HCL | Recombinant Human G3BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G3BP1 Products
Required fields are marked with *
My Review for All G3BP1 Products
Required fields are marked with *
0
Inquiry Basket