Recombinant Full Length Human G6PC Protein

• Cat.No.: G6PC174HF
• Product Overview: Recombinant full length Human glucose-6-phosphatase, catalytic subunit with a N-terminal proprietary tag.Mol Wt 65.34 kDa inclusive of tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 357 amino acids
• Description: Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-phosphatase catalytic-subunit-encoding genes in human: G6PC, G6PC2 and G6PC3. Glucose-6-phosphatase catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate and is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Mutations in this gene cause glycogen storage disease type I (GSD1). This disease, also known as von Gierke disease, is a metabolic disorder characterized by severe hypoglycemia associated with the accumulation of glycogen and fat in the liver and kidneys.
• Form: Liquid
• Molecular Mass: 65.340kDa inclusive of tags
• AA Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLR NAFYVLFPIWFHLQEAVGIKLLWVAVIGDWLNLVFKWILF GQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFW AVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFSHIHS IYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMY RESCKGKLSKWLPFRLSSIVASLVLLHVFDSLKPPSQVEL VFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ]
• Official Symbol: G6PC
• Synonyms: G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a
• Gene ID: 2538
• mRNA Refseq: NM_000151
• Protein Refseq: NP_000142
• MIM: 613742
• UniProt ID: P35575