Recombinant Human G6PC protein, His-sumostar-tagged
| Cat.No. : | G6PC-5755H |
| Product Overview : | Recombinant Human G6PC protein(P35575)(82-117aa), fused with N-terminal His and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His&SUMO |
| Protein Length : | 82-117aa |
| Tag : | N-His-sumostar |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS |
| Gene Name | G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ] |
| Official Symbol | G6PC |
| Synonyms | G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350; |
| Gene ID | 2538 |
| mRNA Refseq | NM_000151 |
| Protein Refseq | NP_000142 |
| MIM | 613742 |
| UniProt ID | P35575 |
| ◆ Recombinant Proteins | ||
| G6PC-6129M | Recombinant Mouse G6PC Protein | +Inquiry |
| G6PC-5122HF | Recombinant Full Length Human G6PC Protein, GST-tagged | +Inquiry |
| G6PC-1543H | Recombinant Human G6PC protein, His-tagged | +Inquiry |
| G6PC174HF | Recombinant Full Length Human G6PC Protein | +Inquiry |
| G6PC-4222H | Recombinant Human G6PC protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G6PC Products
Required fields are marked with *
My Review for All G6PC Products
Required fields are marked with *



