Recombinant Human G6PC protein, His-sumostar-tagged
Cat.No. : | G6PC-5755H |
Product Overview : | Recombinant Human G6PC protein(P35575)(82-117aa), fused with N-terminal His and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 82-117aa |
Tag : | N-His-sumostar |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPS |
Gene Name | G6PC glucose-6-phosphatase, catalytic subunit [ Homo sapiens ] |
Official Symbol | G6PC |
Synonyms | G6PC; glucose-6-phosphatase, catalytic subunit; G6PT, glucose 6 phosphatase, catalytic (glycogen storage disease type I, von Gierke disease); glucose-6-phosphatase; glycogen storage disease type I; von Gierke disease; GSD1a; G6Pase; G-6-Pase; G6Pase-alpha; glucose-6-phosphatase alpha; G6PT; GSD1; G6PC1; MGC163350; |
Gene ID | 2538 |
mRNA Refseq | NM_000151 |
Protein Refseq | NP_000142 |
MIM | 613742 |
UniProt ID | P35575 |
◆ Recombinant Proteins | ||
G6PC-1542H | Recombinant Human G6PC Protein, His-tagged | +Inquiry |
G6PC-27523TH | Recombinant Human G6PC | +Inquiry |
RFL23531HF | Recombinant Full Length Haplochromis Xenognathus Glucose-6-Phosphatase(G6Pc) Protein, His-Tagged | +Inquiry |
G6PC-01HFL | Recombinant Human G6PC Protein, Full Length, N-His tagged | +Inquiry |
G6PC-5755H | Recombinant Human G6PC protein, His-sumostar-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All G6PC Products
Required fields are marked with *
My Review for All G6PC Products
Required fields are marked with *