Recombinant Full Length Human GABARAP Protein, GST-tagged

• Cat.No.: GABARAP-5148HF
• Product Overview: Human GABARAP full-length ORF ( NP_009209.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 117 amino acids
• Description: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq
• Molecular Mass: 40.3 kDa
• AA Sequence: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GABARAP GABA(A) receptor-associated protein [ Homo sapiens ]
• Official Symbol: GABARAP
• Synonyms: GABARAP; GABA(A) receptor-associated protein; gamma-aminobutyric acid receptor-associated protein; ATG8A; MM46; GABARAP-a; FLJ25768; MGC120154; MGC120155
• Gene ID: 11337
• mRNA Refseq: NM_007278
• Protein Refseq: NP_009209
• MIM: 605125
• UniProt ID: O95166