Recombinant Full Length Human GAD2 Protein, C-Flag-tagged
Cat.No. : | GAD2-517HFL |
Product Overview : | Recombinant Full Length Human GAD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-585 aa |
Description : | This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.2 kDa |
AA Sequence : | MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARK AACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNE LLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIA PVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEH SHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAV ADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREG YEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMV ISNPAATHQDIDFLIEEIERLGQDLSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, beta-Alanine metabolism, Butanoate metabolism, Metabolic pathways, Taurine and hypotaurine metabolism, Type I diabetes mellitus |
Full Length : | Full L. |
Gene Name | GAD2 glutamate decarboxylase 2 [ Homo sapiens (human) ] |
Official Symbol | GAD2 |
Synonyms | GAD65 |
Gene ID | 2572 |
mRNA Refseq | NM_001134366.2 |
Protein Refseq | NP_001127838.1 |
MIM | 138275 |
UniProt ID | Q05329 |
◆ Recombinant Proteins | ||
GAD2-26072TH | Recombinant Human GAD2 | +Inquiry |
GAD2-1797R | Recombinant Rhesus monkey GAD2 Protein, His-tagged | +Inquiry |
GAD2-9169H | Recombinant Human GAD2 Protein, His-tagged | +Inquiry |
GAD2-13107H | Recombinant Human GAD2, GST-tagged | +Inquiry |
GAD2-9170H | Recombinant Human GAD2 Protein, N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAD2-001MCL | Recombinant Mouse GAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAD2 Products
Required fields are marked with *
My Review for All GAD2 Products
Required fields are marked with *
0
Inquiry Basket