Recombinant Full Length Human GALC Protein, GST-tagged
| Cat.No. : | GALC-5221HF | 
| Product Overview : | Human GALC full-length ORF ( AAH36518, 27 a.a. - 669 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 27-669 amino acids | 
| Description : | This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq | 
| Molecular Mass : | 96.47 kDa | 
| AA Sequence : | YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDGNYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTTKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFRVEATR | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GALC galactosylceramidase [ Homo sapiens ] | 
| Official Symbol | GALC | 
| Synonyms | GALC; galactosylceramidase; galactosylceramidase (Krabbe disease); galactocerebrosidase; Krabbe disease; GALCERase; galactosylceraminidase; galactocerebroside beta-galactosidase; galactosylceramide beta-galactosidase; | 
| Gene ID | 2581 | 
| mRNA Refseq | NM_000153 | 
| Protein Refseq | NP_000144 | 
| MIM | 606890 | 
| UniProt ID | P54803 | 
| ◆ Recombinant Proteins | ||
| Galc-529R | Recombinant Rat Galc Protein, His-tagged | +Inquiry | 
| GALC-1844H | Recombinant Human GALC Protein (43-685 aa), His-tagged | +Inquiry | 
| GALC-605H | Active Recombinant Human GALC, His-tagged | +Inquiry | 
| Galc-9308MFL | Recombinant Full Length Mouse Galc, Flag-tagged | +Inquiry | 
| GALC-1803R | Recombinant Rhesus monkey GALC Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GALC-679HCL | Recombinant Human GALC cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALC Products
Required fields are marked with *
My Review for All GALC Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            