Recombinant Human GALC Protein (43-685 aa), His-tagged
Cat.No. : | GALC-1844H |
Product Overview : | Recombinant Human GALC Protein (43-685 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 43-685 aa |
Description : | Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 74.8 kDa |
AA Sequence : | YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | GALC galactosylceramidase [ Homo sapiens ] |
Official Symbol | GALC |
Synonyms | GALC; galactosylceramidase; galactocerebrosidase; Krabbe disease; GALCERase; |
Gene ID | 2581 |
mRNA Refseq | NM_000153 |
Protein Refseq | NP_000144 |
MIM | 606890 |
UniProt ID | P54803 |
◆ Recombinant Proteins | ||
GALC-1844H | Recombinant Human GALC Protein (43-685 aa), His-tagged | +Inquiry |
Galc-200M | Recombinant Mouse Galc, Myc-His-tagged | +Inquiry |
Galc-529R | Recombinant Rat Galc Protein, His-tagged | +Inquiry |
Galc-2377M | Recombinant Mouse Galc protein | +Inquiry |
Galc-360M | Recombinant Mouse Galc Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALC-679HCL | Recombinant Human GALC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALC Products
Required fields are marked with *
My Review for All GALC Products
Required fields are marked with *
0
Inquiry Basket