Recombinant Full Length Human GALNT1 Protein
| Cat.No. : | GALNT1-179HF |
| Product Overview : | Recombinant full length Human GALNT1, isoform 2 with N terminal proprietary tag. Predicted MW 37.62 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 105 amino acids |
| Description : | This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. |
| Form : | Liquid |
| Molecular Mass : | 37.620kDa inclusive of tags |
| AA Sequence : | MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKER GLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFK INQFNLMASEMIALNRSLPDVRLEG |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ] |
| Official Symbol | GALNT1 |
| Synonyms | GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1 |
| Gene ID | 2589 |
| mRNA Refseq | NM_020474 |
| Protein Refseq | NP_065207 |
| MIM | 602273 |
| UniProt ID | Q10472 |
| ◆ Recombinant Proteins | ||
| Galnt1-3141M | Recombinant Mouse Galnt1 Protein, Myc/DDK-tagged | +Inquiry |
| GALNT1-4689H | Recombinant Human GALNT1 Protein, GST-tagged | +Inquiry |
| GALNT1-6179M | Recombinant Mouse GALNT1 Protein | +Inquiry |
| GALNT1-27304TH | Recombinant Human GALNT1 | +Inquiry |
| GALNT1-179HF | Recombinant Full Length Human GALNT1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT1 Products
Required fields are marked with *
My Review for All GALNT1 Products
Required fields are marked with *
