Recombinant Full Length Human GALNT1 Protein
Cat.No. : | GALNT1-179HF |
Product Overview : | Recombinant full length Human GALNT1, isoform 2 with N terminal proprietary tag. Predicted MW 37.62 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 37.620kDa inclusive of tags |
Protein Length : | 105 amino acids |
AA Sequence : | MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKER GLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFK INQFNLMASEMIALNRSLPDVRLEG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ] |
Official Symbol : | GALNT1 |
Synonyms : | GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1 |
Gene ID : | 2589 |
mRNA Refseq : | NM_020474 |
Protein Refseq : | NP_065207 |
MIM : | 602273 |
UniProt ID : | Q10472 |
Products Types
◆ Recombinant Protein | ||
GALNT1-1626R | Recombinant Rhesus Macaque GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT1-1253H | Recombinant Human GALNT1 Protein, MYC/DDK-tagged | +Inquiry |
GALNT1-26H | Active Recombinant Human GALNT1 Protein, His-tagged | +Inquiry |
GALNT1-4689H | Recombinant Human GALNT1 Protein, GST-tagged | +Inquiry |
GALNT1-2121R | Recombinant Rat GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket