Recombinant Full Length Human GFER Protein
| Cat.No. : | GFER-190HF |
| Product Overview : | Recombinant full length Human ALR isoform 2 with N-terminal proprietary tag.Mol Wt 39.86 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 125 amino acids |
| Description : | The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. |
| Form : | Liquid |
| Molecular Mass : | 39.860kDa inclusive of tags |
| AA Sequence : | MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDT RTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWK DGSCD |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GFER growth factor, augmenter of liver regeneration [ Homo sapiens ] |
| Official Symbol | GFER |
| Synonyms | GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS |
| Gene ID | 2671 |
| mRNA Refseq | NM_005262 |
| Protein Refseq | NP_005253 |
| MIM | 600924 |
| UniProt ID | P55789 |
| ◆ Recombinant Proteins | ||
| GFER-3536M | Recombinant Mouse GFER Protein, His (Fc)-Avi-tagged | +Inquiry |
| GFER-216H | Recombinant Human GFER, His-SUMO-tagged | +Inquiry |
| GFER-1412H | Recombinant Human GFER Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GFER-190HF | Recombinant Full Length Human GFER Protein | +Inquiry |
| GFER-662H | Recombinant Human GFER Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GFER-5954HCL | Recombinant Human GFER 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFER Products
Required fields are marked with *
My Review for All GFER Products
Required fields are marked with *
