Recombinant Full Length Human GFER Protein

Cat.No. : GFER-190HF
Product Overview : Recombinant full length Human ALR isoform 2 with N-terminal proprietary tag.Mol Wt 39.86 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 125 amino acids
Description : The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Form : Liquid
Molecular Mass : 39.860kDa inclusive of tags
AA Sequence : MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDT RTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWK DGSCD
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GFER growth factor, augmenter of liver regeneration [ Homo sapiens ]
Official Symbol GFER
Synonyms GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS
Gene ID 2671
mRNA Refseq NM_005262
Protein Refseq NP_005253
MIM 600924
UniProt ID P55789

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GFER Products

Required fields are marked with *

My Review for All GFER Products

Required fields are marked with *

0
cart-icon