Recombinant Full Length Human GFOD2 Protein, C-Flag-tagged
Cat.No. : | GFOD2-1809HFL |
Product Overview : | Recombinant Full Length Human GFOD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable nucleotide binding activity and oxidoreductase activity. Predicted to be involved in extracellular matrix organization. Predicted to be located in extracellular region. Predicted to be active in extracellular matrix. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVC ISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEH YVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAA IRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELL LRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDA IKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GFOD2 glucose-fructose oxidoreductase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | GFOD2 |
Gene ID | 81577 |
mRNA Refseq | NM_030819.4 |
Protein Refseq | NP_110446.3 |
MIM | 619933 |
UniProt ID | Q3B7J2 |
◆ Recombinant Proteins | ||
GFOD2-5508H | Recombinant Human GFOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GFOD2-3539M | Recombinant Mouse GFOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFOD2-978H | Recombinant Human GFOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFOD2-4857H | Recombinant Human GFOD2 Protein, GST-tagged | +Inquiry |
GFOD2-2274C | Recombinant Chicken GFOD2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFOD2-697HCL | Recombinant Human GFOD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFOD2 Products
Required fields are marked with *
My Review for All GFOD2 Products
Required fields are marked with *
0
Inquiry Basket