| Species : |
Human |
| Source : |
In Vitro Cell Free System |
| Protein Length : |
289 amino acids |
| Description : |
This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature. |
| Form : |
Liquid |
| Molecular Mass : |
57.860kDa inclusive of tags |
| AA Sequence : |
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPA PLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNL YLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRV KLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPI LSLCLLPSL |
| Purity : |
Proprietary Purification |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |