Recombinant Full Length Human GHSR Protein
Cat.No. : | GHSR-197HF |
Product Overview : | Recombinant full length Human Ghrelin Receptor, Isoform 1B with N terminal proprietary tag, 57.86kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 57.860kDa inclusive of tags |
Protein Length : | 289 amino acids |
AA Sequence : | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPA PLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNL YLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRV KLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPI LSLCLLPSL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | GHSR growth hormone secretagogue receptor [ Homo sapiens ] |
Official Symbol : | GHSR |
Synonyms : | GHSR; growth hormone secretagogue receptor; growth hormone secretagogue receptor type 1 |
Gene ID : | 2693 |
mRNA Refseq : | NM_004122 |
Protein Refseq : | NP_004113 |
MIM : | 601898 |
UniProt ID : | Q92847 |
Products Types
◆ Recombinant Protein | ||
GHSR-1578H | Recombinant Human GHSR Protein, His&GST-tagged | +Inquiry |
GHSR-2188R | Recombinant Rat GHSR Protein, His (Fc)-Avi-tagged | +Inquiry |
GHSR-4895H | Recombinant Human GHSR Protein, GST-tagged | +Inquiry |
GHSR-1043HFL | Recombinant Human GHSR protein, His&Flag-tagged | +Inquiry |
GHSR-3244H | Recombinant Human GHSR Protein (Met1-Arg70), N-GST tagged | +Inquiry |
◆ Assay kits | ||
Kit-1255 | GHSR U2OS β-Arrestin-1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket