Recombinant Human GHSR

Cat.No. : GHSR-29024TH
Product Overview : Recombinant full length Human Ghrelin Receptor, Isoform 1B with N terminal proprietary tag, 57.86kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 289 amino acids
Description : This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature.
Molecular Weight : 57.860kDa inclusive of tags
Tissue specificity : Pituitary and hypothalamus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPA PLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNL YLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRV KLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPI LSLCLLPSL
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name GHSR growth hormone secretagogue receptor [ Homo sapiens ]
Official Symbol GHSR
Synonyms GHSR; growth hormone secretagogue receptor; growth hormone secretagogue receptor type 1;
Gene ID 2693
mRNA Refseq NM_004122
Protein Refseq NP_004113
MIM 601898
Uniprot ID Q92847
Chromosome Location 3q26.31
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function G-protein coupled receptor activity; growth hormone secretagogue receptor activity; growth hormone-releasing hormone receptor activity; peptide hormone binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GHSR Products

Required fields are marked with *

My Review for All GHSR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon