Recombinant Full Length Human GINS1 Protein, GST-tagged
Cat.No. : | GINS1-5263HF |
Product Overview : | Human GINS1 full-length ORF ( AAH12542.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 196 amino acids |
Description : | The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]).[supplied by OMIM |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GINS1 GINS complex subunit 1 (Psf1 homolog) [ Homo sapiens ] |
Official Symbol | GINS1 |
Synonyms | GINS1; GINS complex subunit 1 (Psf1 homolog); DNA replication complex GINS protein PSF1; KIAA0186; PSF1; partner of sld five-1; RP4-691N24.2; |
Gene ID | 9837 |
mRNA Refseq | NM_021067 |
Protein Refseq | NP_066545 |
MIM | 610608 |
UniProt ID | Q14691 |
◆ Recombinant Proteins | ||
GINS1-4908H | Recombinant Human GINS1 Protein, GST-tagged | +Inquiry |
GINS1-5263HF | Recombinant Full Length Human GINS1 Protein, GST-tagged | +Inquiry |
GINS1-1589Z | Recombinant Zebrafish GINS1 | +Inquiry |
GINS1-1973C | Recombinant Chicken GINS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GINS1-5934HCL | Recombinant Human GINS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GINS1 Products
Required fields are marked with *
My Review for All GINS1 Products
Required fields are marked with *
0
Inquiry Basket