Recombinant Full Length Human GINS1 Protein, GST-tagged

Cat.No. : GINS1-5263HF
Product Overview : Human GINS1 full-length ORF ( AAH12542.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 196 amino acids
Description : The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]).[supplied by OMIM
Molecular Mass : 47.3 kDa
AA Sequence : MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GINS1 GINS complex subunit 1 (Psf1 homolog) [ Homo sapiens ]
Official Symbol GINS1
Synonyms GINS1; GINS complex subunit 1 (Psf1 homolog); DNA replication complex GINS protein PSF1; KIAA0186; PSF1; partner of sld five-1; RP4-691N24.2;
Gene ID 9837
mRNA Refseq NM_021067
Protein Refseq NP_066545
MIM 610608
UniProt ID Q14691

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GINS1 Products

Required fields are marked with *

My Review for All GINS1 Products

Required fields are marked with *

0
cart-icon