Recombinant Human GK protein, His-tagged
| Cat.No. : | GK-3238H |
| Product Overview : | Recombinant Human GK protein(1-357 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-357 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GK glycerol kinase [ Homo sapiens ] |
| Official Symbol | GK |
| Synonyms | glycerol kinase; 4289; Ensembl:ENSG00000198814; glycerol kinase;glycerokinase;ATP:glycerol 3-phosphotransferase; 2.7.1.30; GK1; GKD |
| Gene ID | 2710 |
| mRNA Refseq | NM_000167.5 |
| Protein Refseq | NP_000158.1 |
| MIM | 300474 |
| UniProt ID | B4DH54 |
| ◆ Native Proteins | ||
| GK-01B | Active Recombinant Bacillus Stearothermo Glycerol Kinase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GK-5914HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
| GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GK Products
Required fields are marked with *
My Review for All GK Products
Required fields are marked with *
