Recombinant Full Length Human GLRX2 Protein, GST-tagged
Cat.No. : | GLRX2-5347HF |
Product Overview : | Human GLRX2 full-length ORF ( AAH28113, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 124 amino acids |
Description : | Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM |
Molecular Mass : | 39.38 kDa |
AA Sequence : | MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLRX2 glutaredoxin 2 [ Homo sapiens ] |
Official Symbol | GLRX2 |
Synonyms | GLRX2; glutaredoxin 2; bA101E13.1; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); GRX2; CGI-133; |
Gene ID | 51022 |
mRNA Refseq | NM_001243399 |
Protein Refseq | NP_001230328 |
MIM | 606820 |
UniProt ID | Q9NS18 |
◆ Recombinant Proteins | ||
GLRX2-153H | Recombinant Human GLRX2 Protein | +Inquiry |
GLRX2-2571R | Recombinant Rat GLRX2 Protein | +Inquiry |
GLRX2-27693TH | Recombinant Human GLRX2 | +Inquiry |
GLRX2-27694TH | Recombinant Human GLRX2, His-tagged | +Inquiry |
GLRX2-4863H | Recombinant Human GLRX2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRX2 Products
Required fields are marked with *
My Review for All GLRX2 Products
Required fields are marked with *
0
Inquiry Basket