Recombinant Full Length Human GLRX3 Protein, GST-tagged

Cat.No. : GLRX3-5348HF
Product Overview : Human GLRX3 full-length ORF ( AAH05289, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 335 amino acids
Description : This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]
Molecular Mass : 62.59 kDa
AA Sequence : MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLRX3 glutaredoxin 3 [ Homo sapiens ]
Official Symbol GLRX3
Synonyms GLRX3; glutaredoxin 3; thioredoxin like 2, TXNL2; glutaredoxin-3; bA500G10.4; GLRX4; glutaredoxin 4; GRX3; GRX4; PICOT; PKCq-interacting protein; thioredoxin-like protein 2; PKC-theta-interacting protein; PKC-interacting cousin of thioredoxin; TXNL2; TXNL3; FLJ11864;
Gene ID 10539
mRNA Refseq NM_001199868
Protein Refseq NP_001186797
MIM 612754
UniProt ID O76003

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLRX3 Products

Required fields are marked with *

My Review for All GLRX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon