Recombinant Full Length Human GLUD2 Protein, GST-tagged
Cat.No. : | GLUD2-6941HF |
Product Overview : | Recombinant Human full-length GLUD2(1 a.a. - 264 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 558 amino acids |
Description : | The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless. |
Molecular Mass : | 54.78 kDa |
AA Sequence : | MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEG SILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLK NLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSAR QIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ] |
Official Symbol | GLUD2 |
Synonyms | GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial |
Gene ID | 2747 |
mRNA Refseq | NM_012084 |
Protein Refseq | NP_036216 |
MIM | 300144 |
UniProt ID | P49448 |
◆ Recombinant Proteins | ||
GLUD2-13320H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
GLUD2-27654TH | Recombinant Human GLUD2, His-tagged | +Inquiry |
GLUD2-90H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
GLUD2-6941HF | Recombinant Full Length Human GLUD2 Protein, GST-tagged | +Inquiry |
GLUD2-89H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLUD2-716HCL | Recombinant Human GLUD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLUD2 Products
Required fields are marked with *
My Review for All GLUD2 Products
Required fields are marked with *