Recombinant Human GLUD2, His-tagged
| Cat.No. : | GLUD2-27654TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 229-541 of Human GLUD2 with N terminal His tag; 313 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 229-541 a.a. |
| Description : | The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | GEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGR ISATGRGVFHGIENFINEASYMSILGMTPGFRDKTFVV QGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPK ELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAAT EKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNI LVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDS NYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGA SEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVN |
| Gene Name | GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ] |
| Official Symbol | GLUD2 |
| Synonyms | GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial; |
| Gene ID | 2747 |
| mRNA Refseq | NM_012084 |
| Protein Refseq | NP_036216 |
| MIM | 300144 |
| Uniprot ID | P49448 |
| Chromosome Location | Xq24-q25 |
| Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; D-Glutamine and D-glutamate metabolism, organism-specific biosystem; |
| Function | ADP binding; GTP binding; glutamate dehydrogenase (NAD+) activity; glutamate dehydrogenase [NAD(P)+] activity; leucine binding; |
| ◆ Recombinant Proteins | ||
| GLUD2-90H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
| GLUD2-6941HF | Recombinant Full Length Human GLUD2 Protein, GST-tagged | +Inquiry |
| GLUD2-13320H | Recombinant Human GLUD2, GST-tagged | +Inquiry |
| GLUD2-444H | Recombinant Human GLUD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GLUD2-27654TH | Recombinant Human GLUD2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLUD2-716HCL | Recombinant Human GLUD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLUD2 Products
Required fields are marked with *
My Review for All GLUD2 Products
Required fields are marked with *
