Recombinant Human GLUD2, GST-tagged

Cat.No. : GLUD2-90H
Product Overview : Recombinant Human GLUD2(1 a.a. - 264 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.
Molecular Mass : 54.78 kDa
AA Sequence : MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEG SILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLK NLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSAR QIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ]
Official Symbol GLUD2
Synonyms GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial
Gene ID 2747
mRNA Refseq NM_012084
Protein Refseq NP_036216
MIM 300144
UniProt ID P49448
Chromosome Location Xq24-q25
Pathway Proximal tubule bicarbonate reclamation; arginine biosynthesis IV; glutamate biosynthesis II
Function ADP binding; glutamate dehydrogenase (NAD+) activity; glutamate dehydrogenase [NAD(P)+] activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLUD2 Products

Required fields are marked with *

My Review for All GLUD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon