Recombinant Full Length Human GLYATL2 Protein, GST-tagged
Cat.No. : | GLYATL2-5364HF |
Product Overview : | Human GLYATL2 full-length ORF ( AAH16789.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 294 amino acids |
Description : | GLYATL2 (Glycine-N-Acyltransferase Like 2) is a Protein Coding gene. Among its related pathways are Conjugation of carboxylic acids and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and glycine N-acyltransferase activity. An important paralog of this gene is GLYATL1P3. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLYATL2 glycine-N-acyltransferase-like 2 [ Homo sapiens ] |
Official Symbol | GLYATL2 |
Synonyms | GLYATL2; glycine-N-acyltransferase-like 2; glycine N-acyltransferase-like protein 2; BXMAS2 10; MGC24009; glycine acyltransferase family-B; acyl-CoA:glycine N-acyltransferase-like protein 2; GATF-B; BXMAS2-10; |
Gene ID | 219970 |
mRNA Refseq | NM_145016 |
Protein Refseq | NP_659453 |
MIM | 614762 |
UniProt ID | Q8WU03 |
◆ Recombinant Proteins | ||
GLYATL2-454H | Recombinant Human glycine-N-acyltransferase-like 2, His-tagged | +Inquiry |
GLYATL2-5055H | Recombinant Human GLYATL2, His-tagged | +Inquiry |
GLYATL2-5364HF | Recombinant Full Length Human GLYATL2 Protein, GST-tagged | +Inquiry |
GLYATL2-4998H | Recombinant Human GLYATL2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLYATL2-5888HCL | Recombinant Human GLYATL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLYATL2 Products
Required fields are marked with *
My Review for All GLYATL2 Products
Required fields are marked with *
0
Inquiry Basket