Recombinant Full Length Human GLYATL2 Protein, GST-tagged

Cat.No. : GLYATL2-5364HF
Product Overview : Human GLYATL2 full-length ORF ( AAH16789.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 294 amino acids
Description : GLYATL2 (Glycine-N-Acyltransferase Like 2) is a Protein Coding gene. Among its related pathways are Conjugation of carboxylic acids and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and glycine N-acyltransferase activity. An important paralog of this gene is GLYATL1P3.
Molecular Mass : 60.7 kDa
AA Sequence : MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLYATL2 glycine-N-acyltransferase-like 2 [ Homo sapiens ]
Official Symbol GLYATL2
Synonyms GLYATL2; glycine-N-acyltransferase-like 2; glycine N-acyltransferase-like protein 2; BXMAS2 10; MGC24009; glycine acyltransferase family-B; acyl-CoA:glycine N-acyltransferase-like protein 2; GATF-B; BXMAS2-10;
Gene ID 219970
mRNA Refseq NM_145016
Protein Refseq NP_659453
MIM 614762
UniProt ID Q8WU03

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLYATL2 Products

Required fields are marked with *

My Review for All GLYATL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon