Recombinant Human GLYATL2 Protein, GST-tagged
| Cat.No. : | GLYATL2-4998H | 
| Product Overview : | Human GLYATL2 full-length ORF ( AAH16789.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | GLYATL2 (Glycine-N-Acyltransferase Like 2) is a Protein Coding gene. Among its related pathways are Conjugation of carboxylic acids and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and glycine N-acyltransferase activity. An important paralog of this gene is GLYATL1P3. | 
| Molecular Mass : | 60.7 kDa | 
| AA Sequence : | MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GLYATL2 glycine-N-acyltransferase-like 2 [ Homo sapiens ] | 
| Official Symbol | GLYATL2 | 
| Synonyms | GLYATL2; glycine-N-acyltransferase-like 2; glycine N-acyltransferase-like protein 2; BXMAS2 10; MGC24009; glycine acyltransferase family-B; acyl-CoA:glycine N-acyltransferase-like protein 2; GATF-B; BXMAS2-10; | 
| Gene ID | 219970 | 
| mRNA Refseq | NM_145016 | 
| Protein Refseq | NP_659453 | 
| MIM | 614762 | 
| UniProt ID | Q8WU03 | 
| ◆ Recombinant Proteins | ||
| GLYATL2-5364HF | Recombinant Full Length Human GLYATL2 Protein, GST-tagged | +Inquiry | 
| GLYATL2-5055H | Recombinant Human GLYATL2, His-tagged | +Inquiry | 
| GLYATL2-454H | Recombinant Human glycine-N-acyltransferase-like 2, His-tagged | +Inquiry | 
| GLYATL2-4998H | Recombinant Human GLYATL2 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GLYATL2-5888HCL | Recombinant Human GLYATL2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLYATL2 Products
Required fields are marked with *
My Review for All GLYATL2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            