Recombinant Full Length Human GNG2 Protein, GST-tagged

Cat.No. : GNG2-5387HF
Product Overview : Human GNG2 full-length ORF ( AAH20774, 1 a.a. - 71 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 71 amino acids
Description : Heterotrimeric G proteins play vital roles in cellular responses to external signals. The specificity of a G protein-receptor interaction is primarily mediated by the gamma subunit.[supplied by OMIM
Molecular Mass : 33.55 kDa
AA Sequence : MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG2 guanine nucleotide binding protein (G protein), gamma 2 [ Homo sapiens ]
Official Symbol GNG2
Synonyms GNG2; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2; g gamma-I; guanine nucleotide binding protein gamma 2; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit;
Gene ID 54331
mRNA Refseq NM_001243773
Protein Refseq NP_001230702
MIM 606981
UniProt ID P59768

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG2 Products

Required fields are marked with *

My Review for All GNG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon