Recombinant Full Length Human GNG7 Protein
| Cat.No. : | GNG7-222HF |
| Product Overview : | Recombinant full length Human G gamma7 with a N terminal proprietary tag; Predicted MW 33.59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 68 amino acids |
| Description : | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 is a protein that in humans is encoded by the GNG7 gene. |
| Form : | Liquid |
| Molecular Mass : | 33.590kDa inclusive of tags |
| AA Sequence : | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ] |
| Official Symbol | GNG7 |
| Synonyms | GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058 |
| Gene ID | 2788 |
| mRNA Refseq | NM_052847 |
| Protein Refseq | NP_443079 |
| MIM | 604430 |
| UniProt ID | O60262 |
| ◆ Recombinant Proteins | ||
| GNG7-222HF | Recombinant Full Length Human GNG7 Protein | +Inquiry |
| GNG7-6287H | Recombinant Human GNG7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gng7-1038M | Recombinant Mouse Gng7 Protein, MYC/DDK-tagged | +Inquiry |
| GNG7-5073H | Recombinant Human GNG7 Protein, GST-tagged | +Inquiry |
| GNG7-2263R | Recombinant Rat GNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNG7-5850HCL | Recombinant Human GNG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG7 Products
Required fields are marked with *
My Review for All GNG7 Products
Required fields are marked with *



