Recombinant Full Length Human GNG7 Protein

Cat.No. : GNG7-222HF
Product Overview : Recombinant full length Human G gamma7 with a N terminal proprietary tag; Predicted MW 33.59 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 68 amino acids
Description : Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 is a protein that in humans is encoded by the GNG7 gene.
Form : Liquid
Molecular Mass : 33.590kDa inclusive of tags
AA Sequence : MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ]
Official Symbol GNG7
Synonyms GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058
Gene ID 2788
mRNA Refseq NM_052847
Protein Refseq NP_443079
MIM 604430
UniProt ID O60262

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG7 Products

Required fields are marked with *

My Review for All GNG7 Products

Required fields are marked with *

0
cart-icon