Recombinant Full Length Human GNG7 Protein
Cat.No. : | GNG7-222HF |
Product Overview : | Recombinant full length Human G gamma7 with a N terminal proprietary tag; Predicted MW 33.59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 68 amino acids |
Description : | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 is a protein that in humans is encoded by the GNG7 gene. |
Form : | Liquid |
Molecular Mass : | 33.590kDa inclusive of tags |
AA Sequence : | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ] |
Official Symbol | GNG7 |
Synonyms | GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058 |
Gene ID | 2788 |
mRNA Refseq | NM_052847 |
Protein Refseq | NP_443079 |
MIM | 604430 |
UniProt ID | O60262 |
◆ Recombinant Proteins | ||
GNG7-5073H | Recombinant Human GNG7 Protein, GST-tagged | +Inquiry |
GNG7-534Z | Recombinant Zebrafish GNG7 | +Inquiry |
GNG7-2263R | Recombinant Rat GNG7 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG7-5391HF | Recombinant Full Length Human GNG7 Protein, GST-tagged | +Inquiry |
GNG7-1907R | Recombinant Rhesus monkey GNG7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG7-5850HCL | Recombinant Human GNG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG7 Products
Required fields are marked with *
My Review for All GNG7 Products
Required fields are marked with *
0
Inquiry Basket