Recombinant Full Length Human GNLY Protein, GST-tagged

• Cat.No.: GNLY-5399HF
• Product Overview: Human GNLY full-length ORF ( AAH23576, 16 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 16-145 amino acids
• Description: The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
• Molecular Mass: 40.04 kDa
• AA Sequence: NPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNLY granulysin [ Homo sapiens ]
• Official Symbol: GNLY
• Synonyms: GNLY; granulysin; LAG2; D2S69E; LAG 2; NKG5; T lymphocyte activation gene 519; TLA519; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519; 519; LAG-2
• Gene ID: 10578
• mRNA Refseq: NM_006433
• Protein Refseq: NP_006424
• MIM: 188855
• UniProt ID: P22749