Recombinant Human GNLY Protein, GST-tagged
| Cat.No. : | GNLY-5084H |
| Product Overview : | Human GNLY full-length ORF ( AAH23576, 16 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq |
| Molecular Mass : | 40.04 kDa |
| AA Sequence : | NPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNLY granulysin [ Homo sapiens ] |
| Official Symbol | GNLY |
| Synonyms | GNLY; granulysin; LAG2; D2S69E; LAG 2; NKG5; T lymphocyte activation gene 519; TLA519; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519; 519; LAG-2; |
| Gene ID | 10578 |
| mRNA Refseq | NM_006433 |
| Protein Refseq | NP_006424 |
| MIM | 188855 |
| UniProt ID | P22749 |
| ◆ Recombinant Proteins | ||
| GNLY-4380H | Recombinant Human Granulysin, His-tagged | +Inquiry |
| GNLY-4383H | Recombinant Human GNLY protein, hFc-tagged | +Inquiry |
| GNLY-5084H | Recombinant Human GNLY Protein, GST-tagged | +Inquiry |
| GNLY-4835H | Recombinant Human GNLY Protein, His-tagged | +Inquiry |
| GNLY-4381H | Active Recombinant Human GNLY protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNLY-5845HCL | Recombinant Human GNLY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNLY Products
Required fields are marked with *
My Review for All GNLY Products
Required fields are marked with *
