Recombinant Human GNLY Protein, GST-tagged

Cat.No. : GNLY-5084H
Product Overview : Human GNLY full-length ORF ( AAH23576, 16 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Molecular Mass : 40.04 kDa
AA Sequence : NPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNLY granulysin [ Homo sapiens ]
Official Symbol GNLY
Synonyms GNLY; granulysin; LAG2; D2S69E; LAG 2; NKG5; T lymphocyte activation gene 519; TLA519; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519; 519; LAG-2;
Gene ID 10578
mRNA Refseq NM_006433
Protein Refseq NP_006424
MIM 188855
UniProt ID P22749

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNLY Products

Required fields are marked with *

My Review for All GNLY Products

Required fields are marked with *

0
cart-icon