Recombinant Full Length Human Golgi Snap Receptor Complex Member 2(Gosr2) Protein, His-Tagged
Cat.No. : | RFL13153HF |
Product Overview : | Recombinant Full Length Human Golgi SNAP receptor complex member 2(GOSR2) Protein (O14653) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-212) |
Form : | Lyophilized powder |
AA Sequence : | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GOSR2 |
Synonyms | 2310032N09Rik; 27 kDa Golgi SNARE protein; Bos1; EPM6; Golgi SNAP receptor complex member 2; Golgi SNARE ; Gosr2; GOSR2_HUMAN; Gs27; Membrin; SNARE |
UniProt ID | O14653 |
◆ Recombinant Proteins | ||
GOSR2-167H | Recombinant Human GOSR2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GOSR2-5125H | Recombinant Human GOSR2 Protein, GST-tagged | +Inquiry |
GOSR2-3621C | Recombinant Chicken GOSR2 | +Inquiry |
Gosr2-3276M | Recombinant Mouse Gosr2 Protein, Myc/DDK-tagged | +Inquiry |
GOSR2-5433HF | Recombinant Full Length Human GOSR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOSR2-5826HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
GOSR2-5825HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOSR2 Products
Required fields are marked with *
My Review for All GOSR2 Products
Required fields are marked with *
0
Inquiry Basket