Recombinant Human GOSR2 Protein, GST-tagged

Cat.No. : GOSR2-5125H
Product Overview : Human GOSR2 full-length ORF ( NP_473363.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 51 kDa
AA Sequence : MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOSR2 golgi SNAP receptor complex member 2 [ Homo sapiens ]
Official Symbol GOSR2
Synonyms GOSR2; golgi SNAP receptor complex member 2; Golgi SNAP receptor complex member 2; Bos1; GS27; membrin; 27 kDa Golgi SNARE protein; EPM6;
Gene ID 9570
mRNA Refseq NM_001012511
Protein Refseq NP_001012529
MIM 604027
UniProt ID O14653

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOSR2 Products

Required fields are marked with *

My Review for All GOSR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon