Recombinant Full Length Human GOLM1 Protein, C-Flag-tagged
Cat.No. : | GOLM1-1292HFL |
Product Overview : | Recombinant Full Length Human GOLM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | GOLM1 golgi membrane protein 1 [ Homo sapiens (human) ] |
Official Symbol | GOLM1 |
Synonyms | GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3 |
Gene ID | 51280 |
mRNA Refseq | NM_016548.4 |
Protein Refseq | NP_057632.2 |
MIM | 606804 |
UniProt ID | Q8NBJ4 |
◆ Recombinant Proteins | ||
GOLM1-3541H | Recombinant Human GOLM1 Protein (Val40-Leu401), N-His tagged | +Inquiry |
GOLM1-2052H | Recombinant Human GOLM1 Protein, MYC/DDK-tagged | +Inquiry |
GOLM1-1292HFL | Recombinant Full Length Human GOLM1 Protein, C-Flag-tagged | +Inquiry |
Golm1-277M | Recombinant Mouse Golm1 Protein, MYC/DDK-tagged | +Inquiry |
GOLM1-4735H | Recombinant Human GOLM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLM1-1856HCL | Recombinant Human GOLM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOLM1 Products
Required fields are marked with *
My Review for All GOLM1 Products
Required fields are marked with *
0
Inquiry Basket