Recombinant Full Length Human GOSR2 Protein, GST-tagged
Cat.No. : | GOSR2-5433HF |
Product Overview : | Human GOSR2 full-length ORF ( NP_473363.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 213 amino acids |
Description : | This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 51 kDa |
AA Sequence : | MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GOSR2 golgi SNAP receptor complex member 2 [ Homo sapiens ] |
Official Symbol | GOSR2 |
Synonyms | GOSR2; golgi SNAP receptor complex member 2; Golgi SNAP receptor complex member 2; Bos1; GS27; membrin; 27 kDa Golgi SNARE protein; EPM6; |
Gene ID | 9570 |
mRNA Refseq | NM_001012511 |
Protein Refseq | NP_001012529 |
MIM | 604027 |
UniProt ID | O14653 |
◆ Recombinant Proteins | ||
RFL25800MF | Recombinant Full Length Mouse Golgi Snap Receptor Complex Member 2(Gosr2) Protein, His-Tagged | +Inquiry |
GOSR2-7568H | Recombinant Human GOSR2 protein, His-tagged | +Inquiry |
GOSR2-5125H | Recombinant Human GOSR2 Protein, GST-tagged | +Inquiry |
RFL13153HF | Recombinant Full Length Human Golgi Snap Receptor Complex Member 2(Gosr2) Protein, His-Tagged | +Inquiry |
GOSR2-7567H | Recombinant Human GOSR2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOSR2-5825HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
GOSR2-5826HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOSR2 Products
Required fields are marked with *
My Review for All GOSR2 Products
Required fields are marked with *