Recombinant Full Length Human GPR34 Protein
Cat.No. : | GPR34-5539HF |
Product Overview : | Human GPR34 full-length ORF (NP_005291.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 515 amino acids |
Description : | G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM |
Form : | Liquid |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR34 G protein-coupled receptor 34 [ Homo sapiens ] |
Official Symbol | GPR34 |
Synonyms | GPR34; G protein-coupled receptor 34; probable G-protein coupled receptor 34; |
Gene ID | 2857 |
mRNA Refseq | NM_001097579 |
Protein Refseq | NP_001091048 |
MIM | 300241 |
UniProt ID | Q9UPC5 |
◆ Recombinant Proteins | ||
GPR34-5551HF | Recombinant Full Length Human GPR34 Protein, GST-tagged | +Inquiry |
GPR34-3641C | Recombinant Chicken GPR34 | +Inquiry |
GPR34-1952R | Recombinant Rhesus monkey GPR34 Protein, His-tagged | +Inquiry |
RFL28064PF | Recombinant Full Length Pan Paniscus Probable G-Protein Coupled Receptor 34(Gpr34) Protein, His-Tagged | +Inquiry |
GPR34-5539HF | Recombinant Full Length Human GPR34 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR34 Products
Required fields are marked with *
My Review for All GPR34 Products
Required fields are marked with *
0
Inquiry Basket