Recombinant Human GPR34 Protein
| Cat.No. : | GPR34-5234H |
| Product Overview : | Human GPR34 full-length ORF (NP_005291.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM |
| Form : | Liquid |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPR34 G protein-coupled receptor 34 [ Homo sapiens ] |
| Official Symbol | GPR34 |
| Synonyms | GPR34; G protein-coupled receptor 34; probable G-protein coupled receptor 34; |
| Gene ID | 2857 |
| mRNA Refseq | NM_001097579 |
| Protein Refseq | NP_001091048 |
| MIM | 300241 |
| UniProt ID | Q9UPC5 |
| ◆ Recombinant Proteins | ||
| RFL18977MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 34(Gpr34) Protein, His-Tagged | +Inquiry |
| GPR34-5234H | Recombinant Human GPR34 Protein | +Inquiry |
| GPR34-1952R | Recombinant Rhesus monkey GPR34 Protein, His-tagged | +Inquiry |
| GPR34-5539HF | Recombinant Full Length Human GPR34 Protein | +Inquiry |
| GPR34-3641C | Recombinant Chicken GPR34 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR34 Products
Required fields are marked with *
My Review for All GPR34 Products
Required fields are marked with *



