Recombinant Human GPR34 Protein, GST-tagged
| Cat.No. : | GPR34-5235H |
| Product Overview : | Human GPR34 full-length ORF ( NP_005291.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM |
| Molecular Mass : | 70.3 kDa |
| AA Sequence : | MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPR34 G protein-coupled receptor 34 [ Homo sapiens ] |
| Official Symbol | GPR34 |
| Synonyms | GPR34; G protein-coupled receptor 34; probable G-protein coupled receptor 34; |
| Gene ID | 2857 |
| mRNA Refseq | NM_001097579 |
| Protein Refseq | NP_001091048 |
| MIM | 300241 |
| UniProt ID | Q9UPC5 |
| ◆ Recombinant Proteins | ||
| GPR34-5539HF | Recombinant Full Length Human GPR34 Protein | +Inquiry |
| RFL33764HF | Recombinant Full Length Human Probable G-Protein Coupled Receptor 34(Gpr34) Protein, His-Tagged | +Inquiry |
| GPR34-1952R | Recombinant Rhesus monkey GPR34 Protein, His-tagged | +Inquiry |
| GPR34-5551HF | Recombinant Full Length Human GPR34 Protein, GST-tagged | +Inquiry |
| GPR34-1773R | Recombinant Rhesus Macaque GPR34 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR34 Products
Required fields are marked with *
My Review for All GPR34 Products
Required fields are marked with *
