Recombinant Full Length Human GPX7 Protein
| Cat.No. : | GPX7-204HF | 
| Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with N terminal proprietary tag. Predicted MW 46.64 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Protein Length : | 187 amino acids | 
| Description : | Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum. | 
| Form : | Liquid | 
| Molecular Mass : | 46.640kDa inclusive of tags | 
| AA Sequence : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSL EKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWD PTVSVEEVRPQITALVRKLILLKREDL | 
| Purity : | Proprietary Purification | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. | 
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. | 
| Gene Name | GPX7 glutathione peroxidase 7 [ Homo sapiens ] | 
| Official Symbol | GPX7 | 
| Synonyms | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx | 
| Gene ID | 2882 | 
| mRNA Refseq | NM_015696 | 
| Protein Refseq | NP_056511 | 
| MIM | 615784 | 
| UniProt ID | Q96SL4 | 
| ◆ Recombinant Proteins | ||
| GPX7-29078TH | Recombinant Human GPX7, FLAG-tagged | +Inquiry | 
| GPX7-204HF | Recombinant Full Length Human GPX7 Protein | +Inquiry | 
| GPX7-7341H | Recombinant Human GPX7 protein(Met1-Leu187), hFc-tagged | +Inquiry | 
| GPX7-1787R | Recombinant Rhesus Macaque GPX7 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| GPX7-29079TH | Recombinant Human GPX7 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX7 Products
Required fields are marked with *
My Review for All GPX7 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            