Recombinant Full Length Human GPX7 Protein
Cat.No. : | GPX7-204HF |
Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with N terminal proprietary tag. Predicted MW 46.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 187 amino acids |
Description : | Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum. |
Form : | Liquid |
Molecular Mass : | 46.640kDa inclusive of tags |
AA Sequence : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSL EKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWD PTVSVEEVRPQITALVRKLILLKREDL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
Official Symbol | GPX7 |
Synonyms | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx |
Gene ID | 2882 |
mRNA Refseq | NM_015696 |
Protein Refseq | NP_056511 |
MIM | 615784 |
UniProt ID | Q96SL4 |
◆ Recombinant Proteins | ||
GPX7-3975C | Recombinant Chicken GPX7 | +Inquiry |
GPX7-1966R | Recombinant Rhesus monkey GPX7 Protein, His-tagged | +Inquiry |
GPX7-1391H | Recombinant Human Glutathione Peroxidase 7, His-tagged | +Inquiry |
GPX7-204HF | Recombinant Full Length Human GPX7 Protein | +Inquiry |
Gpx7-4281M | Recombinant Mouse Gpx7 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX7 Products
Required fields are marked with *
My Review for All GPX7 Products
Required fields are marked with *
0
Inquiry Basket