Recombinant Full Length Human GPX7 Protein
| Cat.No. : | GPX7-204HF |
| Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with N terminal proprietary tag. Predicted MW 46.64 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 187 amino acids |
| Description : | Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum. |
| Form : | Liquid |
| Molecular Mass : | 46.640kDa inclusive of tags |
| AA Sequence : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSL EKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWD PTVSVEEVRPQITALVRKLILLKREDL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
| Official Symbol | GPX7 |
| Synonyms | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx |
| Gene ID | 2882 |
| mRNA Refseq | NM_015696 |
| Protein Refseq | NP_056511 |
| MIM | 615784 |
| UniProt ID | Q96SL4 |
| ◆ Recombinant Proteins | ||
| GPX7-3975C | Recombinant Chicken GPX7 | +Inquiry |
| GPX7-2234H | Recombinant Human GPX7 Protein, MYC/DDK-tagged | +Inquiry |
| GPX7-5587HF | Recombinant Full Length Human GPX7 Protein, GST-tagged | +Inquiry |
| GPX7-29078TH | Recombinant Human GPX7, FLAG-tagged | +Inquiry |
| GPX7-13511H | Recombinant Human GPX7, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX7 Products
Required fields are marked with *
My Review for All GPX7 Products
Required fields are marked with *



