Recombinant Full Length Human GPX7 Protein
| Cat.No. : | GPX7-204HF |
| Product Overview : | Recombinant full length Human Glutathione Peroxidase 7 with N terminal proprietary tag. Predicted MW 46.64 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Enables catalase activity. Predicted to be involved in cellular response to oxidative stress. Located in endoplasmic reticulum. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 46.640kDa inclusive of tags |
| Protein Length : | 187 amino acids |
| AA Sequence : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSL EKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFN VLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWD PTVSVEEVRPQITALVRKLILLKREDL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name : | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
| Official Symbol : | GPX7 |
| Synonyms : | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx |
| Gene ID : | 2882 |
| mRNA Refseq : | NM_015696 |
| Protein Refseq : | NP_056511 |
| MIM : | 615784 |
| UniProt ID : | Q96SL4 |
Products Types
| ◆ Recombinant Protein | ||
| GPX7-5314H | Recombinant Human GPX7 Protein, GST-tagged | +Inquiry |
| GPX7-2234H | Recombinant Human GPX7 Protein, MYC/DDK-tagged | +Inquiry |
| GPX7-1787R | Recombinant Rhesus Macaque GPX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Gpx7-3300M | Recombinant Mouse Gpx7 Protein, Myc/DDK-tagged | +Inquiry |
| GPX7-2699Z | Recombinant Zebrafish GPX7 | +Inquiry |
| ◆ Lysates | ||
| GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
