Recombinant Full Length Human GSDMC Protein, GST-tagged

Cat.No. : GSDMC-6382HF
Product Overview : Human MLZE full-length ORF ( AAH35321.1, 1 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 508 amino acids
Description : GSDMC (Gasdermin C) is a Protein Coding gene. An important paralog of this gene is GSDMA.
Molecular Mass : 84.1 kDa
AA Sequence : MPSMLERISKNLVKEIGSKDLTSVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRTELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSDMC gasdermin C [ Homo sapiens ]
Official Symbol GSDMC
Synonyms GSDMC; gasdermin C; melanoma derived leucine zipper, extra nuclear factor , MLZE; gasdermin-C; melanoma-derived leucine zipper, extra-nuclear factor; melanoma-derived leucine zipper-containing extranuclear factor; MLZE;
Gene ID 56169
mRNA Refseq NM_031415
Protein Refseq NP_113603
MIM 608384
UniProt ID Q9BYG8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSDMC Products

Required fields are marked with *

My Review for All GSDMC Products

Required fields are marked with *

0
cart-icon