Recombinant Full Length Human GSN Protein, C-Flag-tagged
Cat.No. : | GSN-93HFL |
Product Overview : | Recombinant Full Length Human GSN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 82.9 kDa |
AA Sequence : | MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQI WRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLN GRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESF NNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPAL PAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQII YNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAP ASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPV QVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSV DPLDRAMAELAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | GSN gelsolin [ Homo sapiens (human) ] |
Official Symbol | GSN |
Synonyms | ADF; AGEL |
Gene ID | 2934 |
mRNA Refseq | NM_000177.5 |
Protein Refseq | NP_000168.1 |
MIM | 137350 |
UniProt ID | P06396 |
◆ Recombinant Proteins | ||
GSN-2384R | Recombinant Rat GSN Protein, His (Fc)-Avi-tagged | +Inquiry |
GSN-004H | Recombinant Human GSN Protein | +Inquiry |
GSN-2220H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-529H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-2345H | Recombinant Human GSN Protein (Met433-Ala782), N-His tagged | +Inquiry |
◆ Native Proteins | ||
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSN-5722HCL | Recombinant Human GSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSN Products
Required fields are marked with *
My Review for All GSN Products
Required fields are marked with *
0
Inquiry Basket