Recombinant Full Length Human GSTO2 Protein, GST-tagged
Cat.No. : | GSTO2-3366HF |
Product Overview : | Human GSTO2 full-length ORF ( NP_899062.1, 1 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 243 amino acids |
Description : | The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1, MIM 180901) (Whitbread et al., 2003 [PubMed 12618591]). For background information on GSTs, see MIM 605482.[supplied by OMIM |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSTO2 glutathione S-transferase omega 2 [ Homo sapiens ] |
Official Symbol | GSTO2 |
Synonyms | GSTO2; glutathione S-transferase omega 2; glutathione S-transferase omega-2; GSTO-2; MMA(V) reductase; monomethylarsonic acid reductase; glutathione S-transferase omega 2-2; glutathione-S-transferase-like protein; bA127L20.1 (novel glutathione-S-transferase); glutathione-dependent dehydroascorbate reductase; GSTO 2-2; bA127L20.1; |
Gene ID | 119391 |
mRNA Refseq | NM_001191013 |
Protein Refseq | NP_001177942 |
MIM | 612314 |
UniProt ID | Q9H4Y5 |
◆ Recombinant Proteins | ||
GSTO2-1759Z | Recombinant Zebrafish GSTO2 | +Inquiry |
GSTO2-1996R | Recombinant Rhesus monkey GSTO2 Protein, His-tagged | +Inquiry |
GSTO2-15855H | Recombinant Human GSTO2, His-tagged | +Inquiry |
GSTO2-3366HF | Recombinant Full Length Human GSTO2 Protein, GST-tagged | +Inquiry |
GSTO2-3229H | Recombinant Human GSTO2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO2-5710HCL | Recombinant Human GSTO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTO2 Products
Required fields are marked with *
My Review for All GSTO2 Products
Required fields are marked with *