Recombinant Full Length Human GTF2I Protein
Cat.No. : | GTF2I-214HF |
Product Overview : | Recombinant full length Human TFII I, amino acids 1-274 according to AAH04472, with N terminal proprietary tag; predicted MW: 55.88 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 274 amino acids |
Description : | This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21. |
Form : | Liquid |
Molecular Mass : | 55.880kDa inclusive of tags |
AA Sequence : | MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKS KAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYC VEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFK HPENYDLATLKWILENKAGVSFIIKRPFLEPKKHVGGRVM VTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK EESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GTF2I general transcription factor IIi [ Homo sapiens ] |
Official Symbol | GTF2I |
Synonyms | GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I |
Gene ID | 2969 |
mRNA Refseq | NM_001163636 |
Protein Refseq | NP_001157108 |
MIM | 601679 |
UniProt ID | P78347 |
◆ Recombinant Proteins | ||
GTF2I-1831R | Recombinant Rhesus Macaque GTF2I Protein, His (Fc)-Avi-tagged | +Inquiry |
GTF2I-13601H | Recombinant Human GTF2I, GST-tagged | +Inquiry |
GTF2I-3399HF | Recombinant Full Length Human GTF2I Protein, GST-tagged | +Inquiry |
GTF2I-2010R | Recombinant Rhesus monkey GTF2I Protein, His-tagged | +Inquiry |
GTF2I-29514TH | Recombinant Human GTF2I | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2I-763HCL | Recombinant Human GTF2I cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTF2I Products
Required fields are marked with *
My Review for All GTF2I Products
Required fields are marked with *
0
Inquiry Basket