Recombinant Full Length Human GTF3C6 Protein, GST-tagged
| Cat.No. : | GTF3C6-3419HF |
| Product Overview : | Human GTF3C6 full-length ORF ( NP_612417.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 213 amino acids |
| Description : | RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin.[supplied by OMIM |
| Molecular Mass : | 50.4 kDa |
| AA Sequence : | MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GTF3C6 general transcription factor IIIC, polypeptide 6, alpha 35kDa [ Homo sapiens ] |
| Official Symbol | GTF3C6 |
| Synonyms | GTF3C6; general transcription factor IIIC, polypeptide 6, alpha 35kDa; C6orf51, chromosome 6 open reading frame 51; general transcription factor 3C polypeptide 6; bA397G5.3; TFIIIC35; TFIIIC 35 kDa subunit; transcription factor IIIC 35kDa; transcription factor IIIC subunit 6; transcription factor IIIC 35 kDa subunit; C6orf51; |
| Gene ID | 112495 |
| mRNA Refseq | NM_138408 |
| Protein Refseq | NP_612417 |
| MIM | 611784 |
| UniProt ID | Q969F1 |
| ◆ Recombinant Proteins | ||
| GTF3C6-2754C | Recombinant Chicken GTF3C6 | +Inquiry |
| GTF3C6-3419HF | Recombinant Full Length Human GTF3C6 Protein, GST-tagged | +Inquiry |
| GTF3C6-10600Z | Recombinant Zebrafish GTF3C6 | +Inquiry |
| GTF3C6-1082H | Recombinant Human GTF3C6 | +Inquiry |
| GTF3C6-662H | Recombinant Human general transcription factor IIIC, polypeptide 6, alpha 35kDa, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTF3C6-5688HCL | Recombinant Human GTF3C6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF3C6 Products
Required fields are marked with *
My Review for All GTF3C6 Products
Required fields are marked with *
